PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 335174
Common NameARALYDRAFT_335174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 1097aa    MW: 121472 Da    PI: 6.7102
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
335174genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.51.9e-21126217187
             EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
             f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F ++g 
  335174 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFVRIGL 217
             99*****************************954.4444.48***********************************************97764 PP

2Auxin_resp118.55.6e-39266348183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha +++s+F++++nPras+seF+v+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
      335174 266 AAHANANSSPFTIFFNPRASPSEFIVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 348
                 799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.15E-41116269IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-38120255IPR015300DNA-binding pseudobarrel domain
CDDcd100175.37E-20125219No hitNo description
PfamPF023621.2E-19126217IPR003340B3 DNA binding domain
PROSITE profilePS5086311.35126242IPR003340B3 DNA binding domain
SMARTSM010191.1E-19126242IPR003340B3 DNA binding domain
PfamPF065077.5E-34266348IPR010525Auxin response factor
PfamPF023092.8E-99661054IPR033389AUX/IAA domain
PROSITE profilePS5174524.8019681061IPR000270PB1 domain
SuperFamilySSF542771.63E-89821046No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1097 aa     Download sequence    Send to blast
MKAPSNGFLP TSNEGEKKPI NSQLWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ  60
TDFIPNYPNL PSKLICLLHS VTLHADTETD EVYAQMTLQP VNKYDREALL ASDMGLKLNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFVRIGLSSS HKGTWVCRDE KSQLMLGIRR  240
ANRQTPTLSS SVISSDSMHI GILAAAAHAN ANSSPFTIFF NPRASPSEFI VPLAKYNKAL  300
YAQVSLGMRF RMMFETEDCG VRRYMGTVTG ISDLDPVRWK GSQWRNLQVG WDESTAGDRP  360
SRVSIWEIEP VITPFYICPP PFFRPKYPRQ PGMPDDELDM ENAFKRAMPW MGEDFGMKDA  420
QSSMFPGLSL VQWMSMQQNN PLSGSATPQL PSALSSYNLP NNFASNDPSK LLNFQSPNLS  480
SANSQFNKSN TVNHISQQMQ AQPAMVKSLQ QQQQQQQQQL QQQQQQQLQI SHQQLQQQGN  540
YSNGASAVAN QVSCQNPNQP TGFSQSQLQQ QSMLPSGAKM IHQNINSVGN KGSSQMTSFV  600
QEMQFQQQLE LHNSSQLLRN QQEQSSLHSS QQNLSQNPQQ LQMQQQSSKP SPSQQLQLQL  660
LQKLQQQQQQ QSVPPVSSSL QPQLSVLQQT QSHQLQQLLS SQNQQPLAHG NNSFSASTFM  720
QPPQIQVSHQ QQEQMNNKNL VAAGQSHSGH TDGEAPSCST SPSANHTGHD NVSPTNFLSR  780
NQQQGQAASV SASDSVFDRA SNPVQEHYTK TESRFNQGMV NLKSGGEQFR FKGAVTDQID  840
VSTAGATYCP DVVGPAQQQQ TFPLPSFGFD GDCQSHHPRN NLAFPGNLEA VTSDVLYSQK  900
DFQNLVPNYG NAPRDIETEL SSAAISSQSF GIPSIPFKSG CSNEVGGIND SGIMNGGGLW  960
PNQTQRMRTY TKVQKRGSVG RSIDVTRYSG YDELRHDLAR MFGIEGQLED PLTSDWKLVY  1020
TDHENDILLV GDDPWEEFVN CVQNIKILSS VEVQQMSLDG DLAAIPITNQ ACSETDSGNA  1080
WKVHYEDTSA AASFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1681536945388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU536720.0U53672.2 Arabidopsis thaliana early auxin-induced IAA22 mRNA, complete cds.
GenBankAY6697940.0AY669794.1 Arabidopsis thaliana clone C105352 ARF19 (At1g19220) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893034.10.0hypothetical protein ARALYDRAFT_335174
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLD7KHB30.0D7KHB3_ARALL; Auxin response factor
STRINGfgenesh1_pg.C_scaffold_10017390.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19